PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P04310_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 558aa    MW: 62430.1 Da    PI: 7.7802
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P04310_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.51.1e-083513881954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+  ++  LA+++gL+ +qV++WF N R +
  GSMUA_Achr2P04310_001 351 FEHflHPYPNDVDKHILARQTGLSRSQVSNWFINARVR 388
                            664459******************************88 PP

2BELL98.55.5e-32216284472
                   BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            elqk kakL s++ eVdkrY++y+eq++tv +sFeavag ++a++Y +lA +a+SrhFrcL+d i++qi
  GSMUA_Achr2P04310_001 216 ELQKIKAKLSSMIAEVDKRYRKYCEQMRTVTASFEAVAGKEAARVYSALAHRAMSRHFRCLRDGIVGQI 284
                            8999***************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.8E-48155282IPR006563POX domain
PfamPF075269.2E-42159280IPR006563POX domain
PROSITE profilePS5007111.791329392IPR001356Homeobox domain
SMARTSM003898.4E-9332396IPR001356Homeobox domain
CDDcd000864.14E-11332393No hitNo description
SuperFamilySSF466893.81E-17333398IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-27335398IPR009057Homeodomain-like
PfamPF059202.7E-17349388IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MLSRESSSQS FCVMAHQSHY GEFSTGVDAT MQGFDHHHEL LGVQAGMETL GVPSKQQSSR  60
LAGGFLPRDF PEASNKHRPS ASPWPVDDPS LGSLFPWEGR VSVPFLNARH SDAVAVPQPP  120
QQCVPGDRLQ IGSAYLQQQQ QLFVQDGRVG FHPQQPLQLR NSKFLRPAQE LLSEFCSLRG  180
EISSKRRPNK TSLEDEEKAS LSSSWNQSLH SMDLLELQKI KAKLSSMIAE VDKRYRKYCE  240
QMRTVTASFE AVAGKEAARV YSALAHRAMS RHFRCLRDGI VGQIHAAKKA MGEKDPTAAG  300
TTRGETPRLK LLDKCIRQQK AFHQGMMEQP PWRPQRGLPE RAVSILRAWL FEHFLHPYPN  360
DVDKHILARQ TGLSRSQVSN WFINARVRLW KPMVEEMYLE ETKELDNQSN QAANGPEDSD  420
NPNSNLSFDQ KPLPAQLLVD SESLSSIINS GHHGHQRNDL ISSTHHQDFG VVGDLGFSYN  480
SRSSDNSRAG VSLTLGLQQH NGGGMSFSLL PNSQPSLLFS RETIDGDQQA QFSILDGEAE  540
NLRYRNLMGA QLLHDLAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15338396563Homeobox protein Meis2
3k2a_B1e-15338396563Homeobox protein Meis2
4xrm_A1e-15338396563Homeobox protein Meis2
4xrm_B1e-15338396563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384242.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_009384235.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-115BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM0S5220.0M0S522_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04310_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-113TALE family protein